PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_118448g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 315aa    MW: 35434.8 Da    PI: 6.3497
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_118448g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-151562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEd++l++++++ G  +W++ ++  g+ R++k+c++rw +yl
   MA_118448g0010 15 KGPWSHEEDQILLNYIQRNGHASWRALPELAGLLRCGKSCRLRWTNYL 62
                     79******************************99************97 PP

2Myb_DNA-binding50.16.4e-1668111146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+  ++++++ lG++ W++Ia+ ++ gRt++++k++w +
   MA_118448g0010  68 RGSFTEQEERTIIQLHAILGNR-WSSIASQLP-GRTDNEIKNFWKT 111
                      89********************.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.8E-23665IPR009057Homeodomain-like
PROSITE profilePS5129414.4891062IPR017930Myb domain
SuperFamilySSF466893.51E-2812109IPR009057Homeodomain-like
SMARTSM007175.5E-111464IPR001005SANT/Myb domain
PfamPF002496.2E-141562IPR001005SANT/Myb domain
CDDcd001676.34E-81762No hitNo description
PROSITE profilePS5129425.30963117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2566117IPR009057Homeodomain-like
SMARTSM007171.8E-1567115IPR001005SANT/Myb domain
PfamPF002496.0E-1568111IPR001005SANT/Myb domain
CDDcd001672.81E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MDRAAPCCAK KGLKKGPWSH EEDQILLNYI QRNGHASWRA LPELAGLLRC GKSCRLRWTN  60
YLRPDIKRGS FTEQEERTII QLHAILGNRW SSIASQLPGR TDNEIKNFWK TRLQKRLLKM  120
GLDPSTHVPI AEAKPSAPEG YKALAVTRHK AQWESARLEA EARHSSESLI MSSTSTAGYH  180
TVPSDNPPAD YFLKIWNSEA GKAFRKENHH PNGGGDDPFL SSEIPLSSVS SLCCVKTPEV  240
ISCQPDITMG QTEDKATEEL GFPEPLLDFL DTDDNNNNTN GIQSELRTDF LHQPASPWPE  300
LLDEDYWINI AFSQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28131175108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051856.15e-92Myb domain protein 17 isoform 1
TrEMBLA0A061E1595e-92A0A061E159_THECC; Myb domain protein 17 isoform 1
STRINGGLYMA09G39721.15e-90(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.15e-85myb domain protein 17